PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00266g00512.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 243aa    MW: 26626.7 Da    PI: 10.5393
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00266g00512.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.5e-0760921547
                              HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding 15 avkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  Peaxi162Scf00266g00512.1 60 GLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 92
                              68999***************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001670.001465893No hitNo description
Gene3DG3DSA:1.10.10.603.5E-55992IPR009057Homeodomain-like
SuperFamilySSF466893.97E-85997IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-86095IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MIEATGAAAT SFRKSASMNN LEIFDEQQHL QDSNVDIVAA GYASDDVVHP SERSRERKRG  60
LQKVGKGDWR GISRNFVKTR TPTQVASHAQ KYFIRRNNNN RRRRRSSLFD ITTDAVPGTA  120
KIEDQQMNET TSLENLSMSL LRRTLDPAKL PVTGESSTEN LMIGLNKPVK PIRSIPVPPS  180
SKMANLNLNN TYIQDSSPLS LKLSTSTSSS DEKSPSARHS SAFQAMSSGF NGNGSGDNII  240
SVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592875.16e-96PREDICTED: transcription factor MYB1R1-like
RefseqXP_016432254.16e-96PREDICTED: transcription factor MYB1R1-like
TrEMBLK4BNB64e-82K4BNB6_SOLLC; Uncharacterized protein
STRINGSolyc04g005100.2.11e-81(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114232225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-40MYB_related family protein